PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 496013
Common NameARALYDRAFT_496013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 287aa    MW: 31255.8 Da    PI: 6.6309
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
496013genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-14140184347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
           496013 140 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 184
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.3712984IPR017884SANT domain
SMARTSM007171.9E-73082IPR001005SANT/Myb domain
SuperFamilySSF466895.02E-103386IPR009057Homeodomain-like
CDDcd001673.67E-73379No hitNo description
PROSITE profilePS5129420.772133189IPR017930Myb domain
SuperFamilySSF466897.18E-17135188IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-17136188IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-12137184IPR009057Homeodomain-like
SMARTSM007173.2E-13137187IPR001005SANT/Myb domain
PfamPF002494.9E-13140184IPR001005SANT/Myb domain
CDDcd001671.16E-11140185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MEVLRPTTSH VSGGNWLMDE TKSAVAASGE GATWTAAENK AFENALAVYD DNTPDRWQKV  60
AAVIPGKTVS DVIRQYNDLE ADVSSIEAGL IPVPGYITSP PFTLDWAGGG CNGFNPGHQV  120
CNKRSPAGRS PELERKKGVP WTEEEHKLFL MGLKKYGKGD WRNISRNFVI TRTPTQVASH  180
AQKYFIRQLP GGKDKRRASI HDITTVNLED EASLETSKSS IVVGEQRSRL TAFPWNPTDN  240
NGTHADAFNI TIGNAISGVH SYGQVLLGGF NNADSCYDAQ NTMFQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-182699376RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00568DAPTransfer from AT5G58900Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1188910.0AK118891.1 Arabidopsis thaliana At5g58900 mRNA for putative I-box binding factor, complete cds, clone: RAFL21-22-M07.
GenBankAY5195330.0AY519533.1 Arabidopsis thaliana MYB transcription factor (At5g58900) mRNA, complete cds.
GenBankBT0054730.0BT005473.1 Arabidopsis thaliana clone U51211 putative I-box binding factor (At5g58900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866297.10.0myb family transcription factor
SwissprotQ8S9H71e-105DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLD7MR440.0D7MR44_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.8__1829__AT5G58900.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.10.0Homeodomain-like transcriptional regulator